Description
IGF-1 LR3 1mg is a research-use-only laboratory material supplied for controlled research workflows, compound characterization, and analytical documentation review. It is manufactured under rigorous quality standards to support consistency, traceability, and batch-specific verification for qualified laboratory settings.
Key Product Details
- Manufactured in accordance with rigorous quality standards to support ≥99% purity, as reflected in batch-specific documentation where available.
- Every batch is third-party analyzed for identity, assay/potency, and sterility documentation where applicable.
- Supplied in lyophilized powder form to help preserve stability throughout transport and storage.
- Produced with lot-level traceability to support research documentation and laboratory recordkeeping.
Research Documentation Context
- Supports compound characterization in controlled laboratory settings.
- Provides batch-specific identity and purity documentation for research review.
- Allows lot-level traceability across laboratory documentation workflows.
- Supports comparison of product labeling, analytical documentation, and storage information during research planning.
- Supports analytical review of peptide research materials within a strictly laboratory-focused context.
Specifications and Documentation
- Certificate of Analysis: Available with batch-specific documentation where applicable.
- Material Safety Data Sheet: Coming Soon.
- Handling and Storage Instructions: Coming Soon.
- Product Form: Lyophilized powder.
- Purity Specification: ≥99% purity.
- Intended Use: Laboratory research use only.
IGF-1 LR3 1mg is intended strictly for laboratory research use only. This product is not intended for human or animal consumption, therapeutic use, diagnostic use, clinical use, veterinary use, or as a food, drug, cosmetic, dietary supplement, or household product.
Additional information
| CAS No. | 946870-92-4 |
|---|---|
| Purity | ≥99% |
| Sequence | MFPAMPLSSLFVNAGPVCGLRIFYNNKQYWNKPTGYGSSIRRAPQTGIVDCCFRSCDLRRLEMYCAPLKPAKSA |
| Molecular Formula | C331H519N109O101 |
| Molecular Weight | 9117.60 g/mol |
| Synthesis | Solid-phase synthesis |
| Format | Lyophilized powder |
| Solubility | Soluble in water or 1% acetic acid |
| Stability & Storage | Stable for up to 24 months at -20°C. After reconstitution, may be stored at 4°C for up to 4 weeks or at -20°C for up to 6 months. |
| Applications | Cell growth and differentiation studies, muscle development and aging research, therapeutic research in muscle wasting and metabolic disorders |
| Appearance | White lyophilized powder |
| Shipping Conditions | Shipped at ambient temperature; once received, store at -20°C |
| Regulatory/Compliance | Manufactured in a facility that adheres to cGMP guidelines |
| Safety Information | Refer to provided MSDS |











Reviews
There are no reviews yet.